PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0225s0065.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 605aa    MW: 68620.2 Da    PI: 5.8736
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0225s0065.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3495.43e-151494201353
                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          +el+krmw+d+m+lkrlke++k     k+  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+
  Kalax.0225s0065.1.p  49 DELEKRMWRDKMRLKRLKEQTKT----KDG-VDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDN 133
                          79******************997....677.9********************************************************** PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HH CS
                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          Lr+WWk+kv+fdrngpaai+kyqa+nli++++++ ++   s++h+l+elqDTtlgSLLsalmqhcdppqrrfplekg +pPWWPtG+e+w
  Kalax.0225s0065.1.p 134 LREWWKDKVRFDRNGPAAIAKYQAENLIPGNSEGANS-VGSTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGNPPPWWPTGEEEW 222
                          ******************************9999987.9*************************************************** PP

                          HHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.XXXX CS
                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.slrk 269
                          w++l ++k+qg+ pykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee ++++++++s   +  
  Kalax.0225s0065.1.p 223 WSQLDIPKNQGPLPYKKPHDLKKAWKVGVLTAVIKHMSPDISKIRKLVRQSKCLQDKMTAKESATWLAIINQEETLARELYPDSCfPSYG 312
                          ***********************************************************************************7754455 PP

                          XXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX........................XXXXXXXXXXXXXXXXXXXXX......XXXXXX CS
                 EIN3 270 qspkvtlsceqkedvegkkeskikhvqavktta........................gfpvvrkrkkkpsesakvsskevsrtcqssqfr 335
                          +  ++ +++  ++dveg  + +  + q +k  +                        +++v   rk+kps++    +++ ++tc+   ++
  Kalax.0225s0065.1.p 313 DISSIGFNDCGEYDVEGPGDDHKFEYQDQKPIKltlpdlavkdtkgfttnqppysfvDVSVDIARKRKPSSELNRATEQNIYTCEFLPCP 402
                          88899999999*****77777767888888888999*********************666666666667666666666678********* PP

                          X.XXXXXXXXXXXXXXXX CS
                 EIN3 336 gsetelifadknsisqne 353
                          +se++l+f+d+ s+++++
  Kalax.0225s0065.1.p 403 YSESHLGFHDRISRDNHQ 420
                          ****************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.7E-12949296No hitNo description
Gene3DG3DSA:1.10.3180.107.1E-74169306IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.02E-59175299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MMMFDEMGYC GDVNFFCAPP QVERVEPLQQ NEVDGAVEDD YSDEELDVDE LEKRMWRDKM  60
RLKRLKEQTK TKDGVDAAKQ RQSQEQARRK KMSRAQDGIL KYMLKMMEVC KAQGFVYGII  120
PEKGKPVTGA SDNLREWWKD KVRFDRNGPA AIAKYQAENL IPGNSEGANS VGSTPHTLQE  180
LQDTTLGSLL SALMQHCDPP QRRFPLEKGN PPPWWPTGEE EWWSQLDIPK NQGPLPYKKP  240
HDLKKAWKVG VLTAVIKHMS PDISKIRKLV RQSKCLQDKM TAKESATWLA IINQEETLAR  300
ELYPDSCFPS YGDISSIGFN DCGEYDVEGP GDDHKFEYQD QKPIKLTLPD LAVKDTKGFT  360
TNQPPYSFVD VSVDIARKRK PSSELNRATE QNIYTCEFLP CPYSESHLGF HDRISRDNHQ  420
LSCPFKSISS DPVVMQFHEG KSINFHQSIL QPNQAAQPAS LAQSTFSLPG VGVPEDGQRM  480
INGLMSYYDS NVQKNKFAES QNLNQNVPQP VPQHQHVKYS FNDSQGFTME NNFFDTPNIP  540
ASHHMFVQEQ GHLDPTKMLN PQFEMNHGGN TLQMIYGPTF DAVASDFSDG ISSTYPKQVS  600
VWYP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A9e-831733061134Protein ETHYLENE INSENSITIVE 3
4zds_B9e-831733061134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016682.10.0Ethylene insensitive 3 family protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0R5PAD20.0A0A0R5PAD2_CARPA; Ethylene insensitive 3-like 1
STRINGGLYMA20G12250.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein